GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000945-TA|BGIBMGA000945-PA|undefined
         (123 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK023045-1|BAB14371.1|  177|Homo sapiens protein ( Homo sapiens ...    28   9.5  

>AK023045-1|BAB14371.1|  177|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12983 fis, clone NT2RP3000002. ).
          Length = 177

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query: 61  GRTWC-VGSSPPRIPHRAVFVLQSLLQSSIQFRIPIHPPNVRF 102
           G  WC +GS  P  P    F   SLL S    R+P  P N  F
Sbjct: 116 GAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVF 158


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.323    0.134    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,677,341
Number of Sequences: 224733
Number of extensions: 620866
Number of successful extensions: 735
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 735
Number of HSP's gapped (non-prelim): 1
length of query: 123
length of database: 73,234,838
effective HSP length: 81
effective length of query: 42
effective length of database: 55,031,465
effective search space: 2311321530
effective search space used: 2311321530
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 59 (27.9 bits)