GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000945-TA|BGIBMGA000945-PA|undefined
         (123 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g20060.1 68417.m02935 expressed protein  ; expression support...    26   8.3  

>At4g20060.1 68417.m02935 expressed protein  ; expression supported
           by MPSS
          Length = 1134

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 15/48 (31%), Positives = 22/48 (45%)

Query: 14  LGLCSALSGSTNVAKRLAVIVYPGNIRRVTGHARAECATSIRFQLITG 61
           + L    S ST++A  LA ++ P      T HARA     + F +  G
Sbjct: 257 VSLTKLASRSTHLASELAEVIIPFLGEDKTSHARAAVLRCLHFLIERG 304


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.323    0.134    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,740,541
Number of Sequences: 28952
Number of extensions: 93016
Number of successful extensions: 149
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 148
Number of HSP's gapped (non-prelim): 1
length of query: 123
length of database: 12,070,560
effective HSP length: 73
effective length of query: 50
effective length of database: 9,957,064
effective search space: 497853200
effective search space used: 497853200
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 54 (25.8 bits)