BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000944-TA|BGIBMGA000944-PA|IPR001436|Alpha crystallin, IPR002068|Heat shock protein Hsp20, IPR008978|HSP20-like chaperone (187 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 79 8e-17 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.9 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 4.4 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 5.8 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 79.0 bits (186), Expect = 8e-17 Identities = 42/88 (47%), Positives = 56/88 (63%), Gaps = 3/88 (3%) Query: 100 KLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKS-VYREYNREFLLPKGTNPEAIKS 158 ++ DV Q++PEEI VK VDN +LV KHEEK D V R + R ++LPKG N I S Sbjct: 16 QINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADIVS 75 Query: 159 SLSRDGVLTVEAPLPQL--AITDRNIPI 184 SLS DG+LT+ P ++ +R+IPI Sbjct: 76 SLSSDGILTITCPRKEIEQKNEERSIPI 103 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 1.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 23 EFSSIRERFDAEMRKMEEEMSKFRSELMNRESN 55 E R + +++ E+E++ FR+EL E+N Sbjct: 678 EMQKKRSEYSQLIQEHEKELADFRAELKQTEAN 710 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.4 bits (48), Expect = 4.4 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 89 LIQDEGDGKTLKLRFDVSQY-TPEEIVVKTVDNKL 122 +I + +G+TLK +DV ++ T ++V K D L Sbjct: 1 MISEGAEGQTLKELYDVFKFPTDRDLVRKAFDVSL 35 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 5.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 124 VHAKHEEKSDTKSVYREYNREFLLP 148 V A+HE + + +YR+ RE LP Sbjct: 1133 VRARHERRLYLQRLYRQRAREGTLP 1157 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.130 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,351 Number of Sequences: 2123 Number of extensions: 6782 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 4 length of query: 187 length of database: 516,269 effective HSP length: 60 effective length of query: 127 effective length of database: 388,889 effective search space: 49388903 effective search space used: 49388903 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -