BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000943-TA|BGIBMGA000943-PA|IPR001388|Synaptobrevin (120 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 2.9 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 21 8.9 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 2.9 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 15 KRLAQTQAKVDEVVGIMRVNVEKVLERDQKLSELDNRADALQHGAAQFEQQAGKL 69 +R+A+T + ++V R KV E Q +ADA+Q ++ +Q ++ Sbjct: 840 ERVARTHSDPEKV----RALEAKVAECKQAFDSSSTKADAMQKNVDRYTEQINEI 890 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 1 MEEQGGSSAPRVSDKRLAQT 20 MEE G S P S RLA++ Sbjct: 1442 MEEGGRQSTPPASPARLARS 1461 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.127 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,995 Number of Sequences: 2123 Number of extensions: 1734 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 120 length of database: 516,269 effective HSP length: 57 effective length of query: 63 effective length of database: 395,258 effective search space: 24901254 effective search space used: 24901254 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -