BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000942-TA|BGIBMGA000942-PA|IPR001627|Semaphorin/CD100 antigen, IPR002165|Plexin (207 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.19c |||zf-HIT protein Hit1 |Schizosaccharomyces pombe|c... 26 3.5 SPAC1556.05c |||CGR1 family|Schizosaccharomyces pombe|chr 1|||Ma... 25 6.1 >SPAC4F10.19c |||zf-HIT protein Hit1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 154 Score = 26.2 bits (55), Expect = 3.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 157 EASAPLKTVKASYGQSVHLAAFGKTPDALKDQY 189 E S PLKT+ A Q +H +F K + ++Y Sbjct: 118 EGSVPLKTLDAIQQQRLHNPSFEKLASMILEKY 150 >SPAC1556.05c |||CGR1 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 111 Score = 25.4 bits (53), Expect = 6.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 150 NSTPSICEASAPLKTVKASYGQSVHLAAFGKTP 182 N T +C + P KT K +Y +S LA +TP Sbjct: 3 NGTKGVCVSGKPWKTEKKAYNRS-GLADAQRTP 34 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.323 0.137 0.441 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 915,047 Number of Sequences: 5004 Number of extensions: 32730 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 50 Number of HSP's gapped (non-prelim): 2 length of query: 207 length of database: 2,362,478 effective HSP length: 70 effective length of query: 137 effective length of database: 2,012,198 effective search space: 275671126 effective search space used: 275671126 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -