BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000942-TA|BGIBMGA000942-PA|IPR001627|Semaphorin/CD100 antigen, IPR002165|Plexin (207 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 2.2 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 5.0 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 23 8.7 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/48 (27%), Positives = 21/48 (43%) Query: 149 TNSTPSICEASAPLKTVKASYGQSVHLAAFGKTPDALKDQYVVWFHHS 196 T+S + E+ A + + Y H AL D+Y+ W HH+ Sbjct: 60 TDSQIKLAESVAIFRYLCREYQVPDHWYPADSRRQALVDEYLEWQHHN 107 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.4 bits (48), Expect = 5.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 107 LPLRACAHRYDSCVRCVLD 125 +P+ AHR VRC+LD Sbjct: 801 IPVALAAHRMGRPVRCMLD 819 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 22.6 bits (46), Expect = 8.7 Identities = 26/75 (34%), Positives = 28/75 (37%), Gaps = 18/75 (24%) Query: 137 CRPYTPGLLHDATNSTPSI------CEASAPL---------KTVKASYGQSV---HLAAF 178 CRP TP + + TN P E SA L TVK YG V A Sbjct: 125 CRPRTPSMRVNCTNIPPDTSSEEISSEMSAALGVEIFSDQITTVKTHYGTLVAFFDCPAI 184 Query: 179 GKTPDALKDQYVVWF 193 T AL QY V F Sbjct: 185 TVTDQALARQYTVGF 199 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.137 0.441 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,998 Number of Sequences: 2123 Number of extensions: 8246 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 207 length of database: 516,269 effective HSP length: 61 effective length of query: 146 effective length of database: 386,766 effective search space: 56467836 effective search space used: 56467836 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -