BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000941-TA|BGIBMGA000941-PA|IPR001627|Semaphorin/CD100 antigen, IPR009057|Homeodomain-like (286 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.49 EF127808-1|ABL67945.1| 311|Tribolium castaneum nicotinic acetyl... 22 4.6 EF127807-1|ABL67944.1| 311|Tribolium castaneum nicotinic acetyl... 22 4.6 EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetyl... 22 4.6 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 25.4 bits (53), Expect = 0.49 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Query: 114 YAGTNAEFTKADPVIFRNDLFD 135 YAG NAE KA P+ N+LFD Sbjct: 57 YAGINAETFKAQPL---NELFD 75 >EF127808-1|ABL67945.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 311 Score = 22.2 bits (45), Expect = 4.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Query: 15 LLEASNVARCVSKGKSEPFECRNHIRVLQPLGDGERLYVCGTNAHSPKDWVVY 67 LL NV +SEP E + + + Q + E+ + TNA +W Y Sbjct: 11 LLGPYNVLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDY 63 >EF127807-1|ABL67944.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 311 Score = 22.2 bits (45), Expect = 4.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Query: 15 LLEASNVARCVSKGKSEPFECRNHIRVLQPLGDGERLYVCGTNAHSPKDWVVY 67 LL NV +SEP E + + + Q + E+ + TNA +W Y Sbjct: 11 LLGPYNVLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDY 63 >EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 311 Score = 22.2 bits (45), Expect = 4.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Query: 15 LLEASNVARCVSKGKSEPFECRNHIRVLQPLGDGERLYVCGTNAHSPKDWVVY 67 LL NV +SEP E + + + Q + E+ + TNA +W Y Sbjct: 11 LLGPYNVLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDY 63 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,005 Number of Sequences: 317 Number of extensions: 3586 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 286 length of database: 114,650 effective HSP length: 56 effective length of query: 230 effective length of database: 96,898 effective search space: 22286540 effective search space used: 22286540 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -