BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000939-TA|BGIBMGA000939-PA|undefined (287 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 3.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 3.1 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/31 (35%), Positives = 12/31 (38%), Gaps = 4/31 (12%) Query: 7 GVFGGLYEDGHWEWNENTNTLHFISDLPPQP 37 GVFGG W W E + P QP Sbjct: 166 GVFGG----SAWSWREERQAYYLHQFAPEQP 192 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/31 (35%), Positives = 12/31 (38%), Gaps = 4/31 (12%) Query: 7 GVFGGLYEDGHWEWNENTNTLHFISDLPPQP 37 GVFGG W W E + P QP Sbjct: 166 GVFGG----SAWSWREERQAYYLHQFAPEQP 192 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.140 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,221 Number of Sequences: 429 Number of extensions: 3409 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 287 length of database: 140,377 effective HSP length: 57 effective length of query: 230 effective length of database: 115,924 effective search space: 26662520 effective search space used: 26662520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -