BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000934-TA|BGIBMGA000934-PA|IPR001148|Carbonic anhydrase, eukaryotic (257 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.43 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.43 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.43 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.43 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.43 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.43 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 25 0.43 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.43 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 7.0 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.43 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 153 PDTDYYMTYDGSTTAPACF 171 P TDYY ST PAC+ Sbjct: 25 PGTDYYNPNANSTYPPACY 43 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 7.0 Identities = 13/58 (22%), Positives = 22/58 (37%) Query: 80 GPLSYKYQFHEIHIHYGLHDQFGSEHAINGYSFPAELGDLSNPELRVLTEELENIKYG 137 G L+Y ++ + G EH N + A D SN L+ + + +G Sbjct: 84 GFLTYTKADRDVDLFRGSSTPESPEHYYNQKTLQANNNDASNGNLKFSIDNILKADFG 141 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.139 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,172 Number of Sequences: 317 Number of extensions: 3245 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 9 length of query: 257 length of database: 114,650 effective HSP length: 55 effective length of query: 202 effective length of database: 97,215 effective search space: 19637430 effective search space used: 19637430 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -