GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000931-TA|BGIBMGA000931-PA|IPR006941|Ribonuclease CAF1,
IPR012337|Polynucleotidyl transferase, Ribonuclease H fold
         (318 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          24   2.0  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 267 DSHLTGMAXXXXXXXXXDDNIESSSGHLYGLGAPFSVNVNNFQDNGENGN 316
           DSH++  A          DN+   +  L GL  P   +V++  D+GEN +
Sbjct: 348 DSHMSDRASVSSKNAADSDNMMMITPELLGL-MPSGSSVHS--DSGENNS 394


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.137    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,809
Number of Sequences: 429
Number of extensions: 4206
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 140,377
effective HSP length: 58
effective length of query: 260
effective length of database: 115,495
effective search space: 30028700
effective search space used: 30028700
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)