BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000931-TA|BGIBMGA000931-PA|IPR006941|Ribonuclease CAF1, IPR012337|Polynucleotidyl transferase, Ribonuclease H fold (318 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 2.0 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.8 bits (49), Expect = 2.0 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query: 267 DSHLTGMAXXXXXXXXXDDNIESSSGHLYGLGAPFSVNVNNFQDNGENGN 316 DSH++ A DN+ + L GL P +V++ D+GEN + Sbjct: 348 DSHMSDRASVSSKNAADSDNMMMITPELLGL-MPSGSSVHS--DSGENNS 394 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.137 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,809 Number of Sequences: 429 Number of extensions: 4206 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 318 length of database: 140,377 effective HSP length: 58 effective length of query: 260 effective length of database: 115,495 effective search space: 30028700 effective search space used: 30028700 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -