BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000930-TA|BGIBMGA000930-PA|IPR014001|DEAD-like helicases, N-terminal, IPR001650|Helicase, C-terminal, IPR001005|Myb, DNA-binding, IPR014021|Helicase superfamily 1 and 2 ATP-binding, IPR009057|Homeodomain-like, IPR000330|SNF2-related (1026 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 31 0.030 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 24 4.6 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 31.5 bits (68), Expect = 0.030 Identities = 29/138 (21%), Positives = 55/138 (39%), Gaps = 4/138 (2%) Query: 421 GPPYTTDEHLVYNCGKLTILDKLLPKLQEQES-RVLIFSQMTRMLDILEDYCLWRQYKYC 479 G T E + K KL+ L++ + R LIF + R D L + + + Sbjct: 378 GSACTDVEQKFFQVSKFDKRSKLVSILEKAPNERTLIFVETKRNADFLATFLSEQNIQST 437 Query: 480 RLDGQTPHEDRNRQIEEYNMEGSEKFVFMLSTRAGGLGINLTSADVVIIYDSDWNPQMDL 539 + G +R + + ++ G K +++T G+++ VI YD + + Sbjct: 438 SIHGDRYQSEREKALLDFKT-GHRKV--LVATGVAARGLDIKDVQHVINYDLPKSIDEYV 494 Query: 540 QAMDRAHRIGQKKQVRVF 557 + R R+G K + F Sbjct: 495 HRIGRTGRVGNKGKATSF 512 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 816 NEKYGRDDIENIAKDVEGKTP 836 +EKYG +E + D EG+ P Sbjct: 201 DEKYGVPTLEELGFDTEGRLP 221 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,311 Number of Sequences: 317 Number of extensions: 8800 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 2 length of query: 1026 length of database: 114,650 effective HSP length: 64 effective length of query: 962 effective length of database: 94,362 effective search space: 90776244 effective search space used: 90776244 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -