BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000929-TA|BGIBMGA000929-PA|undefined (124 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 26 0.092 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 26 0.092 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 4.6 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 20 8.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 8.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 8.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 8.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 8.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 26.2 bits (55), Expect = 0.092 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 65 LRKKTEALVKSINGNINLNFDDTGSDSTSID 95 + +TE L+ + IN N D+ S +TSID Sbjct: 1 MENETEPLLSGVVSQINGNSGDSTSSATSID 31 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 26.2 bits (55), Expect = 0.092 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 65 LRKKTEALVKSINGNINLNFDDTGSDSTSID 95 + +TE L+ + IN N D+ S +TSID Sbjct: 1 MENETEPLLSGVVSQINGNSGDSTSSATSID 31 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 4.6 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 47 PITNRLQSELALTLSRSN 64 PI+NR++ E+A ++ N Sbjct: 82 PISNRIRHEMATPMATMN 99 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 19.8 bits (39), Expect = 8.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 23 REPTKLDFLGTDMPDGILSDGNDIP 47 RE +D D +LS GN+ P Sbjct: 9 RESPNIDHNSCSSDDTVLSVGNENP 33 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.0 Identities = 8/37 (21%), Positives = 21/37 (56%) Query: 38 GILSDGNDIPITNRLQSELALTLSRSNLRKKTEALVK 74 G++S G + +T++L+ + +L ++ + +VK Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQFIVK 122 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.0 Identities = 8/37 (21%), Positives = 21/37 (56%) Query: 38 GILSDGNDIPITNRLQSELALTLSRSNLRKKTEALVK 74 G++S G + +T++L+ + +L ++ + +VK Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQFIVK 122 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.0 Identities = 8/37 (21%), Positives = 21/37 (56%) Query: 38 GILSDGNDIPITNRLQSELALTLSRSNLRKKTEALVK 74 G++S G + +T++L+ + +L ++ + +VK Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQFIVK 122 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.0 Identities = 8/37 (21%), Positives = 21/37 (56%) Query: 38 GILSDGNDIPITNRLQSELALTLSRSNLRKKTEALVK 74 G++S G + +T++L+ + +L ++ + +VK Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQFIVK 122 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.309 0.129 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,589 Number of Sequences: 317 Number of extensions: 918 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 124 length of database: 114,650 effective HSP length: 50 effective length of query: 74 effective length of database: 98,800 effective search space: 7311200 effective search space used: 7311200 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.4 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -