BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000927-TA|BGIBMGA000927- PA|IPR000175|Sodium:neurotransmitter symporter (632 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 3.4 SPBC28F2.06c |mdm12||Mdm10/Mdm12/Mmm1 complex subunit Mdm12|Schi... 27 7.9 >SPAC806.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 72 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/41 (26%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 113 VIVSSIVMLYYNLIIAWTIFYMTVSFSSIFYQLPWQNCKAE 153 +++++I++ ++N W +F+ + F I YQL ++N +E Sbjct: 26 LLITTILLCFFNATTYWKLFFGAM-FDFIHYQLLFRNSLSE 65 >SPBC28F2.06c |mdm12||Mdm10/Mdm12/Mmm1 complex subunit Mdm12|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 318 LITLSSYNKFSNNCYIDSLIVAVSNIATSFFAGLVIFSVIGFLAHELNVSVDRV 371 + L+ K ++ C++D+L+ A+S L + S+IG +L +V +V Sbjct: 195 IAVLAKMGKRTHLCFVDTLLHGTGEHASSVIRDLTVESIIGESNKQLLKNVAKV 248 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.327 0.141 0.455 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,785,344 Number of Sequences: 5004 Number of extensions: 111568 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 301 Number of HSP's gapped (non-prelim): 2 length of query: 632 length of database: 2,362,478 effective HSP length: 77 effective length of query: 555 effective length of database: 1,977,170 effective search space: 1097329350 effective search space used: 1097329350 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -