BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000926-TA|BGIBMGA000926-PA|IPR001585|Transaldolase, IPR004730|Transaldolase AB (332 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.7 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 4.9 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.0 bits (47), Expect = 3.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Query: 211 PGVV--SVTKIYNYYKKFGYKTQVMGASFRNTGEIRELA 247 PGVV V+ Y KF + G +F TG ++LA Sbjct: 165 PGVVYKCVSDNGESYAKFTISVTIDGETFEGTGPSKKLA 203 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 4.9 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 204 TYEGKEDPGVVSVTKIYNYYKKFGYKTQVMGASFRNTG 241 TY G E+ G+V T IY Y + G +T + N G Sbjct: 389 TYYG-EEIGMVDNTTIYKYDVRDGCRTPFQWDNSINAG 425 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.132 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,448 Number of Sequences: 429 Number of extensions: 2892 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 332 length of database: 140,377 effective HSP length: 58 effective length of query: 274 effective length of database: 115,495 effective search space: 31645630 effective search space used: 31645630 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -