BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000925-TA|BGIBMGA000925-PA|IPR006811|Ssu72-like protein (179 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 25 0.36 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 1.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 5.8 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.7 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 7.7 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 25.0 bits (52), Expect = 0.36 Identities = 11/50 (22%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 83 FQVCNERFDVIITCEERVYDQVIEWFGSR-RSIYNQPVHVVNIDIQDNHE 131 F C E F + C++++ ++ W+ I N ++++ + IQ E Sbjct: 68 FNTCGEVFSAWVRCQDQILIFLVNWYPRLIIGIMNSTLNLIFLLIQTRFE 117 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 14 KGFNVKSYGTGE 25 +G N KSYG GE Sbjct: 2578 RGLNAKSYGPGE 2589 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 1.9 Identities = 5/24 (20%), Positives = 16/24 (66%) Query: 154 DNDIDELLHEFESKCHRPILNCIM 177 + + L+ + E++CH+P ++ ++ Sbjct: 147 NEETKRLVEDLEAECHKPYIDVVV 170 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 5.8 Identities = 5/21 (23%), Positives = 14/21 (66%) Query: 154 DNDIDELLHEFESKCHRPILN 174 + + D+L+ + +C++P +N Sbjct: 154 NEETDKLVEVLKEECYKPFIN 174 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 20.6 bits (41), Expect = 7.7 Identities = 5/21 (23%), Positives = 14/21 (66%) Query: 154 DNDIDELLHEFESKCHRPILN 174 + + D+L+ + +C++P +N Sbjct: 154 NEETDKLVEVLKEECYKPFVN 174 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 20.6 bits (41), Expect = 7.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 103 QVIEWFGSRRSIYNQPVHVVNIDIQDNH 130 QV WF +RRS Y + + + +N+ Sbjct: 164 QVKIWFQNRRSKYKKMMKAAQVSGGNNN 191 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.139 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,154 Number of Sequences: 317 Number of extensions: 2135 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 179 length of database: 114,650 effective HSP length: 53 effective length of query: 126 effective length of database: 97,849 effective search space: 12328974 effective search space used: 12328974 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -