BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000924-TA|BGIBMGA000924-PA|IPR001063|Ribosomal protein L22/L17 (203 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 3.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.9 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.1 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 22.2 bits (45), Expect = 3.0 Identities = 12/38 (31%), Positives = 16/38 (42%) Query: 30 WTKATAPKSFIQNNKKIYPPQQIDEPTRPAFVCHQKTN 67 W + K QN K+I QID F+ Q T+ Sbjct: 204 WFQNRRAKERKQNKKRIEEKSQIDNLFHNGFMQEQSTH 241 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 6.9 Identities = 8/34 (23%), Positives = 14/34 (41%) Query: 23 TNSLHLAWTKATAPKSFIQNNKKIYPPQQIDEPT 56 T+S+ +W P ++ Y P D+ T Sbjct: 1214 TDSILASWKPPVEPNGIVEYYTVYYKPVSTDDKT 1247 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 9.1 Identities = 6/13 (46%), Positives = 8/13 (61%) Query: 117 IKDHNVEFKSNLW 129 + DH +F SN W Sbjct: 261 LSDHGTQFISNTW 273 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 118 KDHNVEFKSNLWV 130 K NVE +NLWV Sbjct: 306 KQLNVEHAANLWV 318 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,396 Number of Sequences: 317 Number of extensions: 2352 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 203 length of database: 114,650 effective HSP length: 54 effective length of query: 149 effective length of database: 97,532 effective search space: 14532268 effective search space used: 14532268 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -