BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000924-TA|BGIBMGA000924-PA|IPR001063|Ribosomal protein L22/L17 (203 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 8.5 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 22.6 bits (46), Expect = 8.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 157 YKYSHYFVRLEEGKPPTDYYKRKPLLPSNQLQDWLEQMRRRKIT 200 +K + + GKPP + +P+ + L LE++ +R++T Sbjct: 469 WKRQQLVLLTKSGKPPGEPSSYRPICLLSVLGKILERLIQRRLT 512 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,837 Number of Sequences: 2123 Number of extensions: 9182 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 1 length of query: 203 length of database: 516,269 effective HSP length: 61 effective length of query: 142 effective length of database: 386,766 effective search space: 54920772 effective search space used: 54920772 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -