GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000924-TA|BGIBMGA000924-PA|IPR001063|Ribosomal protein
L22/L17
         (203 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcript...    23   8.5  

>AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcriptase
           protein.
          Length = 988

 Score = 22.6 bits (46), Expect = 8.5
 Identities = 11/44 (25%), Positives = 23/44 (52%)

Query: 157 YKYSHYFVRLEEGKPPTDYYKRKPLLPSNQLQDWLEQMRRRKIT 200
           +K     +  + GKPP +    +P+   + L   LE++ +R++T
Sbjct: 469 WKRQQLVLLTKSGKPPGEPSSYRPICLLSVLGKILERLIQRRLT 512


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.135    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,837
Number of Sequences: 2123
Number of extensions: 9182
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 203
length of database: 516,269
effective HSP length: 61
effective length of query: 142
effective length of database: 386,766
effective search space: 54920772
effective search space used: 54920772
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)