BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000920-TA|BGIBMGA000920-PA|IPR006875|Sarcoglycan complex subunit protein (311 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.54 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 5.0 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 5.0 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 25.4 bits (53), Expect = 0.54 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 3/74 (4%) Query: 21 NAPTVNVGNENRTNHKCLPAIFFRGWR--RNLLYGILIFLMILVFLNIALTLWIISALKL 78 N T +GN R H+ R + LL+G+L + + L W+ L L Sbjct: 274 NVSTEVIGNILRLMHRRFEITALRLFTIDNKLLFGVLAYYSTTCDIATILDFWVRCVLSL 333 Query: 79 NMNGI-GPIKIMNG 91 + + G IM+G Sbjct: 334 HCAAVGGSANIMSG 347 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 52 YGILIFLMILVFLNIAL 68 Y IL F I+V+LN A+ Sbjct: 330 YNILYFCRIMVYLNSAI 346 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 272 QRGIRSMKVYQLCACATG 289 +RG++ +Y+L C TG Sbjct: 61 ERGLKYYPIYKLDVCGTG 78 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,486 Number of Sequences: 317 Number of extensions: 2703 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 311 length of database: 114,650 effective HSP length: 57 effective length of query: 254 effective length of database: 96,581 effective search space: 24531574 effective search space used: 24531574 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -