BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000920-TA|BGIBMGA000920-PA|IPR006875|Sarcoglycan complex subunit protein (311 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0772 - 5999333-5999881,6001105-6001315,6001791-6001858 42 8e-04 >01_01_0772 - 5999333-5999881,6001105-6001315,6001791-6001858 Length = 275 Score = 41.5 bits (93), Expect = 8e-04 Identities = 33/120 (27%), Positives = 50/120 (41%), Gaps = 4/120 (3%) Query: 104 NLVASTISTQPAHPITLHSHRNFTVLVSDPKHSEHSKLLIKRDNIEFSGKMFHV-RDSR- 161 ++ +ST T+ H I H R+ + D H + D S +HV RD+R Sbjct: 13 SVASSTQDTERYHTIFYHVSRDTRKVSYDFNHVSRDTHEVSCDTCRVSDDFYHVSRDTRK 72 Query: 162 -GGDVFRASKEEVRVYADTFAVDGIGGLVVKTALQVPLVRA-PPGSDLQLESLTRGLDLR 219 D + S++ V DT+ V ++ L++ L A P D LE L RG R Sbjct: 73 VSDDFYHVSRDTCEVSDDTYQVAATPSSAMRIILRIRLSPAWTPEEDACLERLARGYGFR 132 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.137 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,476,210 Number of Sequences: 37544 Number of extensions: 333941 Number of successful extensions: 663 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 663 Number of HSP's gapped (non-prelim): 1 length of query: 311 length of database: 14,793,348 effective HSP length: 82 effective length of query: 229 effective length of database: 11,714,740 effective search space: 2682675460 effective search space used: 2682675460 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -