GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000919-TA|BGIBMGA000919-PA|IPR001214|SET
         (697 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    29   0.11 
AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    23   7.1  

>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 29.1 bits (62), Expect = 0.11
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 453 DLPSTLEISNFDIKPDLPIVNDNEHS-SDLNSFVYTDTHLGGKNCDKKESLTETDLPIAT 511
           D    LE+SN + K    +   + +S  DL+   + D  L G +  KK+ L   DL + T
Sbjct: 94  DFAYFLEVSNNNFKTYSNVTTCSYYSLDDLSEDTFYDIRLWGVSFSKKQILRSDDLAVKT 153

Query: 512 ATEDKI 517
            ++  +
Sbjct: 154 TSKSLV 159


>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 23.0 bits (47), Expect = 7.1
 Identities = 8/12 (66%), Positives = 11/12 (91%)

Query: 488 DTHLGGKNCDKK 499
           DTHLGG++ D+K
Sbjct: 52  DTHLGGEDFDQK 63


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.133    0.391 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,466
Number of Sequences: 317
Number of extensions: 6246
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 2
length of query: 697
length of database: 114,650
effective HSP length: 62
effective length of query: 635
effective length of database: 94,996
effective search space: 60322460
effective search space used: 60322460
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 46 (22.6 bits)