BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000919-TA|BGIBMGA000919-PA|IPR001214|SET (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0244 + 21822811-21823246,21823337-21823468,21823949-218240... 40 0.007 09_02_0368 - 7984894-7984905,7985250-7985301,7985947-7985969,798... 39 0.012 02_04_0581 - 24068122-24068355,24068693-24068906,24069675-240697... 38 0.027 03_01_0482 - 3686954-3688564 37 0.047 08_02_0824 + 21561699-21562415,21563294-21563362,21563424-215634... 35 0.19 08_01_0695 + 6148873-6150051 35 0.19 04_03_0961 + 21263735-21263773,21264157-21264279,21266774-212668... 35 0.19 02_05_0473 + 29319824-29322511,29322659-29322820,29324133-293242... 33 0.77 09_04_0537 + 18410201-18410207,18410301-18410586,18410674-184107... 33 1.0 10_07_0166 - 13746208-13746326,13746461-13746532,13746925-137471... 31 2.3 03_01_0448 - 3444608-3444814,3446419-3446497,3446567-3446691,344... 31 3.1 09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096,255... 30 7.2 04_04_1098 + 30876785-30876835,30876846-30877171,30877396-308774... 29 9.5 >09_06_0244 + 21822811-21823246,21823337-21823468,21823949-21824037, 21824135-21824224,21825033-21825603,21826097-21826734, 21826978-21827098,21827223-21827337,21828234-21829723, 21829830-21829901,21830151-21830196,21830413-21830515, 21830591-21830674,21831035-21831475,21831651-21831746, 21831896-21832045,21832131-21832274,21832414-21832527, 21832621-21832803,21832901-21832945,21833058-21833192 Length = 1764 Score = 39.9 bits (89), Expect = 0.007 Identities = 24/67 (35%), Positives = 28/67 (41%), Gaps = 6/67 (8%) Query: 193 GPAAYINHDCRPTCT---FEATDRGKAFVRVLRDIEPGEEITCYY---GEDFFGNSNCYC 246 G A +INH C+P C + K R I PGEEIT Y ED C+C Sbjct: 1695 GIARFINHSCQPNCVAKIISVRNEKKVVFFAERHINPGEEITYDYHFNREDEGQRIPCFC 1754 Query: 247 ECETCER 253 C R Sbjct: 1755 RSRGCRR 1761 >09_02_0368 - 7984894-7984905,7985250-7985301,7985947-7985969, 7987006-7987071,7987155-7987206,7987617-7987820, 7987937-7988017,7988103-7988236 Length = 207 Score = 39.1 bits (87), Expect = 0.012 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Query: 197 YINHDCRPTCTFEA-TDRGKAFVRV--LRDIEPGEEITCYYGEDFFG-NSNCYCECETCE 252 +INH C P + T G+ V + LRDI+ GEE+T Y FG + +C+C C Sbjct: 31 FINHSCEPNTEMQKWTVEGETRVGIFALRDIKTGEELTYDYKFVQFGADQDCHCGSSNCR 90 Query: 253 R 253 + Sbjct: 91 K 91 >02_04_0581 - 24068122-24068355,24068693-24068906,24069675-24069755, 24069853-24070024,24070806-24070884,24071384-24071477, 24072065-24072147,24072284-24072401,24072457-24072461 Length = 359 Score = 37.9 bits (84), Expect = 0.027 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 197 YINHDCRPTCTFEATD-RGKAFVRVL--RDIEPGEEITCYYGEDFFGNS-NCYCECETCE 252 ++NH C P C E G+ V V R I+ GE +T Y FG CYC + C+ Sbjct: 170 FLNHSCDPNCKLEKWQVDGETRVGVFASRSIQVGEHLTYDYRFVHFGEKVKCYCGAQNCQ 229 >03_01_0482 - 3686954-3688564 Length = 536 Score = 37.1 bits (82), Expect = 0.047 Identities = 24/51 (47%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Query: 186 NCAQ-LWLGPAAYINHDCRPTCTFEATDRGK-AFVRVLRDIEPGEEITCYY 234 NC LW+ PA +INH C P T G A V RDI+ GEEIT Y Sbjct: 309 NCGVGLWILPA-FINHSCHPNA--RRTHVGDHAIVHASRDIKAGEEITFAY 356 >08_02_0824 + 21561699-21562415,21563294-21563362,21563424-21563459, 21564533-21564600,21565259-21565277,21565662-21565763, 21566173-21566288,21566501-21566595,21568093-21568264, 21568413-21568493,21569732-21569801,21570106-21570132 Length = 523 Score = 35.1 bits (77), Expect = 0.19 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 12/116 (10%) Query: 149 ERIDFLVGCIAEMTEEE--EKQLLHPGKNDFSVMYSCRKNC-----AQLWLGPAAYINHD 201 E+ DF++ + E+ ++E E++L + Y C+ A + NH Sbjct: 396 EKDDFVIEFVGEVIDDETCEERLEDMRRRGDKNFYMCKVKKDFVIDATFKGNDCRFFNHS 455 Query: 202 CRPTCTFEATD-RGKAFVRVL--RDIEPGEEITC-YYGEDFFG-NSNCYCECETCE 252 C P C + GK + V + IE GE +T Y E +G C+C + C+ Sbjct: 456 CEPNCQLQKWQVNGKTRLGVFASKAIEVGEPLTYDYRFEQHYGPEIECFCGAQNCQ 511 >08_01_0695 + 6148873-6150051 Length = 392 Score = 35.1 bits (77), Expect = 0.19 Identities = 30/102 (29%), Positives = 38/102 (37%), Gaps = 16/102 (15%) Query: 195 AAYINHDCRPT-CTFEATDR---GKA--FVRVLRDIEPGEEITCYY----------GEDF 238 A+ +NHDC P C F+ DR G VR L DI G E+ Y + Sbjct: 206 ASLLNHDCLPNACHFDYADRPGPGNTDIVVRALHDITEGREVCLSYFAANWQYKDRQQRL 265 Query: 239 FGNSNCYCECETCERRGKGAFSVESSHNDEQSTRYRFRETDN 280 + CECE C+ K +S D T E N Sbjct: 266 LEDYGFRCECERCQVESKWKQDDDSDGGDGDDTMEEEEEDGN 307 >04_03_0961 + 21263735-21263773,21264157-21264279,21266774-21266847, 21266939-21267095,21267554-21267694,21267739-21267823, 21268810-21268903,21269041-21269239,21269515-21269549, 21270076-21270631,21270722-21270882,21271704-21271718, 21273078-21273330,21273439-21273562,21273688-21273788, 21274870-21274938,21275060-21275191,21275270-21275404, 21275489-21275551,21275636-21275881,21276007-21276285 Length = 1026 Score = 35.1 bits (77), Expect = 0.19 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 195 AAYINHDCRPTC-TFEATDRGKAFVRVL--RDIEPGEEITCYYGEDFFGNSNCYCECETC 251 A +INH C+P C T + G+ V + +DI G E++ Y ++FG + C C Sbjct: 231 ARFINHSCQPNCETRKWNVLGEVRVGIFAKQDIPIGTELSYDYNFEWFGGAMVRCLCGAG 290 Query: 252 ERRGKGAFSVESSHNDEQSTRYRFRETDNRIN 283 G F S +++T Y + + D+R + Sbjct: 291 SCSG---FLGAKSRGFQEAT-YLWEDDDDRFS 318 >02_05_0473 + 29319824-29322511,29322659-29322820,29324133-29324249, 29324360-29324469,29324504-29324540,29324696-29324862, 29325002-29325089,29325163-29325270 Length = 1158 Score = 33.1 bits (72), Expect = 0.77 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 7/67 (10%) Query: 197 YINHDCRPTCT-----FEATDRGKAFVRVL--RDIEPGEEITCYYGEDFFGNSNCYCECE 249 +INH C P + E+ D A + + +DI GEE+ YG+ C C C Sbjct: 1090 FINHSCSPNLSTRLVSVESKDCQLAHIGLFANQDILMGEELAYDYGQKLLPGDGCPCHCG 1149 Query: 250 TCERRGK 256 RG+ Sbjct: 1150 AKNCRGR 1156 >09_04_0537 + 18410201-18410207,18410301-18410586,18410674-18410773, 18410881-18411147,18411286-18411363,18411444-18411545, 18411628-18411677,18411793-18411889,18412248-18412361, 18412495-18412666,18412865-18413217,18413812-18413898, 18413981-18414001 Length = 577 Score = 32.7 bits (71), Expect = 1.0 Identities = 12/31 (38%), Positives = 22/31 (70%) Query: 241 NSNCYCECETCERRGKGAFSVESSHNDEQST 271 +S+ +C CE+C+R+G + ESS + +QS+ Sbjct: 372 DSSTFCSCESCDRKGLPDVTPESSQSVQQSS 402 >10_07_0166 - 13746208-13746326,13746461-13746532,13746925-13747104, 13747737-13747785 Length = 139 Score = 31.5 bits (68), Expect = 2.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 196 AYINHDCRPTCTFEATDRGKAFVRVLRDIEPGEEI-TCY 233 ++ NHDC P A ++ LR+IE GEE+ CY Sbjct: 70 SFYNHDCDPNTHIVWLASADARLKALRNIEEGEELRICY 108 >03_01_0448 - 3444608-3444814,3446419-3446497,3446567-3446691, 3446765-3446809,3447070-3447165,3447344-3447417, 3447526-3447649,3447975-3448109,3448206-3448535, 3448610-3448762,3448840-3449391,3449569-3449648, 3450395-3450506,3450579-3450749,3450820-3450879 Length = 780 Score = 31.1 bits (67), Expect = 3.1 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Query: 464 DIKPDLPIVNDNEHSSDLNSFVYTDTHLGGKNCDKKESLTETDLPIATATEDKIEIIESK 523 +++ D PI++DNE SF Y + H+ ++KE + D + +D I+S Sbjct: 422 ELENDYPILSDNEEIDAQQSFAYANDHMPYGTDNEKEK--DDDRELNQCEDDHETKIKSP 479 Query: 524 SKV 526 +K+ Sbjct: 480 AKI 482 >09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096, 2550893-2550988,2551418-2551482,2551558-2551591, 2552469-2552540,2552567-2552644,2553416-2553477, 2554267-2554530,2555057-2555246,2555432-2555500, 2555613-2555669,2555746-2555846,2556029-2556146, 2556225-2556272,2556362-2556487,2556960-2557118, 2558119-2558216,2558324-2558416,2559741-2559937, 2560231-2560354,2561121-2561334,2561773-2561830, 2561955-2562433 Length = 1022 Score = 29.9 bits (64), Expect = 7.2 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Query: 195 AAYINHDCRPTC---TFEATDRGKAFVRVLRDIEPGEEITCYYGEDFFGNSN---CYCEC 248 A INH C P C + RDI P EE+T Y F + CYC Sbjct: 926 AHLINHSCEPNCYSRVISVLGDEHIIIFAKRDINPWEELT--YDYRFVSSDQRLPCYCGF 983 Query: 249 ETC 251 C Sbjct: 984 PKC 986 >04_04_1098 + 30876785-30876835,30876846-30877171,30877396-30877418, 30877687-30879392 Length = 701 Score = 29.5 bits (63), Expect = 9.5 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Query: 253 RRGKGAFSVESSHNDEQSTRYRFRETDNRINRTKAKQVQKSSNVKNSDKTRISSRQNSSI 312 R+GK ++ S D + F E+D+ +R K K S N DK R + ++ Sbjct: 376 RKGK---RMDDSDTDSEGDG-SFSESDSDYDRKKKKSTNSSRNESKDDKPRRKAPKDKYS 431 Query: 313 VSPLSMKEMKQKGLTKY 329 P S + G +KY Sbjct: 432 DGPESGSDSDHGGKSKY 448 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.133 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,965,657 Number of Sequences: 37544 Number of extensions: 758549 Number of successful extensions: 1311 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 1305 Number of HSP's gapped (non-prelim): 14 length of query: 697 length of database: 14,793,348 effective HSP length: 87 effective length of query: 610 effective length of database: 11,527,020 effective search space: 7031482200 effective search space used: 7031482200 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -