BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000915-TA|BGIBMGA000915-PA|IPR001042|Peptidase A11B, Ty1 A and B (327 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 28 0.11 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 28 0.11 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 28 0.11 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 4.0 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 5.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.3 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 27.9 bits (59), Expect = 0.11 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 7/99 (7%) Query: 119 NDANHLQNDIAKTDRQLKNTDRLIEMQYGNFNTTQNENDKKLNQMQEQVDRLETLETEQA 178 ND L+ IAK++++ TD L++ + E + Q+ V++L T + E A Sbjct: 5 NDEKALEQ-IAKSEKEPSLTD-LVQRWLERTPGLELEGFNFWGKYQKAVEKLLTEQKELA 62 Query: 179 QKKANETIEDVEALRLRLSHLQKDILKIESDAEQVKHEA 217 +K+ ET++ R +L+ L+K ES + HEA Sbjct: 63 EKEEAETLK-----RYKLNDLEKRREVYESIFKVEVHEA 96 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 0.11 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 7/99 (7%) Query: 119 NDANHLQNDIAKTDRQLKNTDRLIEMQYGNFNTTQNENDKKLNQMQEQVDRLETLETEQA 178 ND L+ IAK++++ TD L++ + E + Q+ V++L T + E A Sbjct: 165 NDEKALEQ-IAKSEKEPSLTD-LVQRWLERTPGLELEGFNFWGKYQKAVEKLLTEQKELA 222 Query: 179 QKKANETIEDVEALRLRLSHLQKDILKIESDAEQVKHEA 217 +K+ ET++ R +L+ L+K ES + HEA Sbjct: 223 EKEEAETLK-----RYKLNDLEKRREVYESIFKVEVHEA 256 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 0.11 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 7/99 (7%) Query: 119 NDANHLQNDIAKTDRQLKNTDRLIEMQYGNFNTTQNENDKKLNQMQEQVDRLETLETEQA 178 ND L+ IAK++++ TD L++ + E + Q+ V++L T + E A Sbjct: 165 NDEKALEQ-IAKSEKEPSLTD-LVQRWLERTPGLELEGFNFWGKYQKAVEKLLTEQKELA 222 Query: 179 QKKANETIEDVEALRLRLSHLQKDILKIESDAEQVKHEA 217 +K+ ET++ R +L+ L+K ES + HEA Sbjct: 223 EKEEAETLK-----RYKLNDLEKRREVYESIFKVEVHEA 256 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 22 EKEGQSTIPDLLSNITNIQKLITKTEQKIKNSN 54 E+E + T + SN+ +Q+ K E N+N Sbjct: 433 EEEDEETSTTVFSNVEVVQEEAKKEESDSNNNN 465 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 201 KDILKIESDAEQVKHEADDVVNRAEGAEL-KARQLRQNF---KQTNKSL 245 K + K+ DA+ K + D++V + K +QL ++F K+ N+ + Sbjct: 142 KPVKKVLEDADMTKDQIDEIVLVGGSTRIPKIQQLIKDFFDGKELNRGI 190 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/40 (27%), Positives = 19/40 (47%) Query: 277 LKLLANMEELYNDHNEQLNTLENEIAVLNTQMNYYLSEIT 316 +K+L +EEL +N N +N L + +L + T Sbjct: 38 IKILNRLEELDLSNNRLRNVPDNSFHFLRSLKKVHLQDNT 77 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.308 0.124 0.317 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,191 Number of Sequences: 317 Number of extensions: 2217 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 327 length of database: 114,650 effective HSP length: 57 effective length of query: 270 effective length of database: 96,581 effective search space: 26076870 effective search space used: 26076870 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -