BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000914-TA|BGIBMGA000914-PA|undefined (276 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118673-1|AAM50533.1| 1436|Drosophila melanogaster AT03687p pro... 29 5.3 AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA... 29 5.3 >AY118673-1|AAM50533.1| 1436|Drosophila melanogaster AT03687p protein. Length = 1436 Score = 29.5 bits (63), Expect = 5.3 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 131 WLGPDAPDAYIKELCHRVRS-ALERFETLTDEMPKEVDLRSFLRPSRVVWALLVRAAEGR 189 WLG + + CH+ ++ +L T +DL+ L +RVV+A A+E R Sbjct: 538 WLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPR 597 Query: 190 N 190 N Sbjct: 598 N 598 >AE014134-2538|AAF53422.1| 1801|Drosophila melanogaster CG3491-PA protein. Length = 1801 Score = 29.5 bits (63), Expect = 5.3 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 131 WLGPDAPDAYIKELCHRVRS-ALERFETLTDEMPKEVDLRSFLRPSRVVWALLVRAAEGR 189 WLG + + CH+ ++ +L T +DL+ L +RVV+A A+E R Sbjct: 903 WLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPR 962 Query: 190 N 190 N Sbjct: 963 N 963 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.321 0.135 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,707,902 Number of Sequences: 52641 Number of extensions: 405847 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 795 Number of HSP's gapped (non-prelim): 2 length of query: 276 length of database: 24,830,863 effective HSP length: 84 effective length of query: 192 effective length of database: 20,409,019 effective search space: 3918531648 effective search space used: 3918531648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -