BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000914-TA|BGIBMGA000914-PA|undefined (276 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.3 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 23 3.9 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 21 9.1 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Query: 241 ESREELVFEMRVPLARSFSAETATLHTVAMFIGPV 275 E REE + R+ A A T +H A +GPV Sbjct: 593 EEREEFRRQERMRYAAPHKAFTYRMHGYASVVGPV 627 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 22.6 bits (46), Expect = 3.9 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Query: 4 LSEDRDIPALLCNACINVILENIFILLNTNVF----LDAELNTTVSPME 48 L ED L CI L + L+N NVF D LN T M+ Sbjct: 41 LLEDESERMLRKRGCIEACLFHRLALMNDNVFDVSKFDVYLNDTDMDMD 89 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 8 RDIPALLCNACINVILENIFILLNTNVF 35 RD+ L AC + +E + +L + +F Sbjct: 39 RDLQPLFKLACTDTFMEGVIVLAFSGLF 66 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.135 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,706 Number of Sequences: 429 Number of extensions: 2414 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 276 length of database: 140,377 effective HSP length: 57 effective length of query: 219 effective length of database: 115,924 effective search space: 25387356 effective search space used: 25387356 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -