BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000912-TA|BGIBMGA000912-PA|IPR011704|ATPase associated with various cellular activities, AAA-5 (255 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 25 0.89 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 6.3 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.6 bits (51), Expect = 0.89 Identities = 10/14 (71%), Positives = 12/14 (85%) Query: 101 PATISRMGIILMSP 114 PA +SR+GIIL SP Sbjct: 379 PAVLSRIGIILASP 392 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 55 IDPEWIESLNSVLDDNRLLTLPSGWRVQFGNN 86 +D I+++N + +D RLL PS R + Sbjct: 217 VDGFRIDAINHMFEDARLLDEPSANRTDLSKD 248 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.133 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,202 Number of Sequences: 429 Number of extensions: 2407 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 255 length of database: 140,377 effective HSP length: 56 effective length of query: 199 effective length of database: 116,353 effective search space: 23154247 effective search space used: 23154247 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -