Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000911-TA|BGIBMGA000911-PA|IPR013602|Dynein heavy chain,
N-terminal region 2
         (560 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    26   2.3  

>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 26.2 bits (55), Expect = 2.3
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 342 THQFSSLLSAMTHRTPGTV-----PTASLNGKNVSVSVWCGVAATLNPSSRGYGG 391
           + QFSS  +A+ +   GT      P  + +    + +V   VAA+++P S G GG
Sbjct: 603 SEQFSSAAAAVANYALGTFKSDFPPIPNSSAAAAAAAVAAAVAASVSPGSGGGGG 657


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.134    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 495,154
Number of Sequences: 2123
Number of extensions: 17087
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 560
length of database: 516,269
effective HSP length: 67
effective length of query: 493
effective length of database: 374,028
effective search space: 184395804
effective search space used: 184395804
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 50 (24.2 bits)