BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000911-TA|BGIBMGA000911-PA|IPR013602|Dynein heavy chain, N-terminal region 2 (560 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 24 3.2 AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-mon... 24 3.2 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 24 3.2 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 24 3.2 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 24 3.2 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 24 3.2 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 12 RNALYFQDFYFLSDDDLLELLGQ 34 RNA +DFY+ + D + L+G+ Sbjct: 14 RNAAELKDFYYKTFPDAVPLIGE 36 >AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 101 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 12 RNALYFQDFYFLSDDDLLELLGQ 34 RNA +DFY+ + D + L+G+ Sbjct: 29 RNAAELKDFYYKTFPDAVPLIGE 51 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 12 RNALYFQDFYFLSDDDLLELLGQ 34 RNA +DFY+ + D + L+G+ Sbjct: 247 RNAAELKDFYYKTFPDAVPLIGE 269 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 12 RNALYFQDFYFLSDDDLLELLGQ 34 RNA +DFY+ + D + L+G+ Sbjct: 247 RNAAELKDFYYKTFPDAVPLIGE 269 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.8 bits (49), Expect = 3.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 12 RNALYFQDFYFLSDDDLLELLGQ 34 RNA +DFY+ + D + L+G+ Sbjct: 247 RNAAELKDFYYKTFPDAVPLIGE 269 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.8 bits (49), Expect = 3.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Query: 331 NRLTSDTLAAVTHQFSSLLSAMTHRTPGTVPTASLNGK 368 NR T + TH + S T TP T P +S G+ Sbjct: 267 NRFTRHLIQRRTHTRHTTTSHNTRGTPRTTPASSRCGQ 304 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,582 Number of Sequences: 317 Number of extensions: 4042 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 6 length of query: 560 length of database: 114,650 effective HSP length: 60 effective length of query: 500 effective length of database: 95,630 effective search space: 47815000 effective search space used: 47815000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -