Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000907-TA|BGIBMGA000907-PA|IPR013026|Tetratricopeptide
region, IPR013105|Tetratricopeptide TPR_2
         (349 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    24   1.9  
AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450 ...    22   7.6  
AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450 ...    22   7.6  

>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 23.8 bits (49), Expect = 1.9
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 3   SSRYYSASRLGTDAKPRTAIIVDEDDELYSGFNEVAPALDTRNLRED 49
           ++R++   R+  +++    I+ D   E+Y+   E       RN+RED
Sbjct: 298 AARFFEIDRINAESRKPIRILFDVSSEIYN--VEYKNVEFWRNIRED 342


>AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 491

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)

Query: 281 AMLDVEPPTY 290
           A+LD EPPTY
Sbjct: 330 AVLDEEPPTY 339


>AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q4 protein.
          Length = 491

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)

Query: 281 AMLDVEPPTY 290
           A+LD EPPTY
Sbjct: 330 AVLDEEPPTY 339


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.130    0.367 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,767
Number of Sequences: 317
Number of extensions: 2649
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 3
length of query: 349
length of database: 114,650
effective HSP length: 57
effective length of query: 292
effective length of database: 96,581
effective search space: 28201652
effective search space used: 28201652
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 44 (21.8 bits)