BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000907-TA|BGIBMGA000907-PA|IPR013026|Tetratricopeptide region, IPR013105|Tetratricopeptide TPR_2 (349 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 25 1.3 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 3.9 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 24.6 bits (51), Expect = 1.3 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Query: 187 GDTHNLDLTFAVLCNLADQYA---------LNEMYTEALNTYQLLTRNKLFPHANRL 234 G HN D TF V CN D L ++Y ++ + + LF H +RL Sbjct: 208 GIYHNDDKTFLVWCNEEDHLRIISMQMGGDLGQVYRRLVHAVNEIEKRLLFSHNDRL 264 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.0 bits (47), Expect = 3.9 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 42 DTRNLREDETFQETLRTAG--IGRKLPSRTGT 71 DTR L+++ Q RTAG R+ PSR T Sbjct: 327 DTRPLKKEPITQSNKRTAGNLATREHPSRNFT 358 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.130 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,487 Number of Sequences: 429 Number of extensions: 3303 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 349 length of database: 140,377 effective HSP length: 58 effective length of query: 291 effective length of database: 115,495 effective search space: 33609045 effective search space used: 33609045 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -