BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000904-TA|BGIBMGA000904-PA|IPR008979|Galactose-binding like, IPR012919|Sad1/UNC-like, C-terminal (235 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 26 0.22 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.3 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 26.2 bits (55), Expect = 0.22 Identities = 12/38 (31%), Positives = 23/38 (60%) Query: 104 AFKGSKGQAMIRLLGTVKVMGVSVEHIPAHISPTREIS 141 +FK SK ++ + + + ++ ++ HI HI PT+ IS Sbjct: 35 SFKLSKIRSFLNITASAVLLPFAIYHIFMHIVPTKLIS 72 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 107 GSKGQAMIRLLGTVKVMGVSVEHIPAHISPTREIS 141 G + ++I + +++++ ++HI I P+ IS Sbjct: 1128 GDEKASLINIADSLEMLNKRLDHIEKTIDPSGHIS 1162 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 107 GSKGQAMIRLLGTVKVMGVSVEHIPAHISPTREIS 141 G + ++I + +++++ ++HI I P+ IS Sbjct: 1128 GDEKASLINIADSLEMLNKRLDHIEKTIDPSGHIS 1162 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 107 GSKGQAMIRLLGTVKVMGVSVEHIPAHISPTREIS 141 G + ++I + +++++ ++HI I P+ IS Sbjct: 1128 GDEKASLINIADSLEMLNKRLDHIEKTIDPSGHIS 1162 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 107 GSKGQAMIRLLGTVKVMGVSVEHIPAHISPTREIS 141 G + ++I + +++++ ++HI I P+ IS Sbjct: 1128 GDEKASLINIADSLEMLNKRLDHIEKTIDPSGHIS 1162 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,340 Number of Sequences: 317 Number of extensions: 2329 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 235 length of database: 114,650 effective HSP length: 55 effective length of query: 180 effective length of database: 97,215 effective search space: 17498700 effective search space used: 17498700 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -