BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000903-TA|BGIBMGA000903-PA|IPR000717|Proteasome component region PCI (386 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 28 0.38 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 2.7 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 8.1 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 8.1 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 28.3 bits (60), Expect = 0.38 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Query: 299 ISELQIEEKDVEAFVIEVL-KTRLVRARMDQAQRTVRVSNTMHRTFGREQWQQLRDVLLA 357 IS+L +E K E V + K + ++ AQ +R N RT E+ +LR+ L Sbjct: 916 ISKLTVEIKTSERNVQKSKDKINSMEDEVEAAQSAIRKGND-ERTQLEEEANKLREELEE 974 Query: 358 WRANVHQAHEAMKSV 372 + + +AHE S+ Sbjct: 975 MKLAIEKAHEGSSSI 989 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 2.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Query: 252 SYQTFYNNHKEFVHSQGLNHEQNIKKMRIL 281 +Y+ ++ KEFV SQG++ +Q + + I+ Sbjct: 334 NYKISFDAVKEFVDSQGISQKQILPRKEII 363 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 23.8 bits (49), Expect = 8.1 Identities = 11/49 (22%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 305 EEKDVEAFVIEVLKTRLVRARMDQAQRTVRVSNTMHRTFGREQWQQLRD 353 E KD++ + E L+T+ R Q + +++ ++ + +Q++ LR+ Sbjct: 63 EGKDLKRILPEALRTKCARCSPIQKENALKIITRLYYDY-PDQYRALRE 110 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 23.8 bits (49), Expect = 8.1 Identities = 11/49 (22%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 305 EEKDVEAFVIEVLKTRLVRARMDQAQRTVRVSNTMHRTFGREQWQQLRD 353 E KD++ + E L+T+ R Q + +++ ++ + +Q++ LR+ Sbjct: 63 EGKDLKRILPEALRTKCARCSPIQKENALKIITRLYYDY-PDQYRALRE 110 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.134 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,076 Number of Sequences: 2123 Number of extensions: 13301 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 4 length of query: 386 length of database: 516,269 effective HSP length: 65 effective length of query: 321 effective length of database: 378,274 effective search space: 121425954 effective search space used: 121425954 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -