BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000902-TA|BGIBMGA000902-PA|undefined (115 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 2.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 22 6.3 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 22 6.3 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 21 8.4 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 82 NLDFLDNMPSTDASNITAQELLN 104 NL N P TD IT QE++N Sbjct: 439 NLSPTINTPETDPVPITRQEIIN 461 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 88 NMPSTDASNITAQELLN 104 N P TD IT QE++N Sbjct: 384 NTPETDPVPITRQEIIN 400 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Query: 60 GPQHSFPSLHNTSSFAGQTA 79 GP HS PS H T +G T+ Sbjct: 1525 GPNHSSPSNH-TDDSSGSTS 1543 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 41 GPMPTSMMAQNGPVQTQANGPQHSFPSLHNTSS 73 G + + Q GP T N PQ+ F S +N ++ Sbjct: 117 GSSNSRFLRQFGPQFTGTNRPQNWFYSRNNNNN 149 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 41 GPMPTSMMAQNGPVQTQANGPQHSFPSLHNTSS 73 G +S + Q GP T PQ+ F S +N ++ Sbjct: 117 GSSNSSFLRQFGPQFTGTKRPQNWFYSRNNNNN 149 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.125 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,955 Number of Sequences: 2123 Number of extensions: 2448 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 115 length of database: 516,269 effective HSP length: 56 effective length of query: 59 effective length of database: 397,381 effective search space: 23445479 effective search space used: 23445479 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -