BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000901-TA|BGIBMGA000901-PA|undefined (154 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117195-14|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical... 28 3.4 Z83223-4|CAB05716.2| 534|Caenorhabditis elegans Hypothetical pr... 27 4.4 >AL117195-14|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical protein Y57A10A.18 protein. Length = 1456 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Query: 106 RPYPQHPRQYSPEWRHVLMQQQAASRQQFPHHHQGS 141 +P Q +Q S QQQ + Q HHHQ S Sbjct: 1327 QPQQQQQQQASMSMSQATYQQQHQQQNQMHHHHQTS 1362 >Z83223-4|CAB05716.2| 534|Caenorhabditis elegans Hypothetical protein E01G4.4 protein. Length = 534 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 100 MRRAAPRPYPQHPRQYSPEWRHVLMQQQAASRQQFPHHHQ 139 M APR Q +QY + ++ +MQ Q +QQ +H Q Sbjct: 64 MNAYAPR--QQQQQQYQQQQQNYMMQHQQQHQQQHHYHQQ 101 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.324 0.133 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,175,857 Number of Sequences: 27539 Number of extensions: 65000 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 293 Number of HSP's gapped (non-prelim): 3 length of query: 154 length of database: 12,573,161 effective HSP length: 76 effective length of query: 78 effective length of database: 10,480,197 effective search space: 817455366 effective search space used: 817455366 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -