BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000901-TA|BGIBMGA000901-PA|undefined (154 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 7.4 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 20 9.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 20 9.8 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 2.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Query: 105 PRPYPQHPRQYSPEWRHVLMQQQAASRQQ 133 P+ Q P+Q P+ + QQQ QQ Sbjct: 1517 PQQQSQQPQQQQPQPQQQQQQQQQQQPQQ 1545 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 108 YPQHPRQYSPEWRHVLMQQQAASRQQFPHHHQ 139 +PQ Q P+ + QQQ +QQ Q Sbjct: 821 HPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQ 852 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 125 QQQAASRQQFP 135 QQQA+S+QQ P Sbjct: 1310 QQQASSQQQIP 1320 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 7.4 Identities = 11/36 (30%), Positives = 12/36 (33%), Gaps = 4/36 (11%) Query: 107 PYPQHPRQYSPEW----RHVLMQQQAASRQQFPHHH 138 P+ HP QY P H PHHH Sbjct: 318 PHQHHPSQYHPHRGSSPHHQHGNHTMGPTMGPPHHH 353 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 20.2 bits (40), Expect = 9.8 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 119 WRHVLMQQQAASRQQFPHHHQGSFF 143 +R + + + + F H +QG FF Sbjct: 401 YRKLPREMRQRITEYFEHRYQGKFF 425 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 20.2 bits (40), Expect = 9.8 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 119 WRHVLMQQQAASRQQFPHHHQGSFF 143 +R + + + + F H +QG FF Sbjct: 369 YRKLPREMRQRITEYFEHRYQGKFF 393 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.324 0.133 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,019 Number of Sequences: 429 Number of extensions: 1617 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 154 length of database: 140,377 effective HSP length: 53 effective length of query: 101 effective length of database: 117,640 effective search space: 11881640 effective search space used: 11881640 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -