BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000901-TA|BGIBMGA000901-PA|undefined (154 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 2.2 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 25 5.1 >SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 26.2 bits (55), Expect = 2.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 109 PQHPRQYSPEWRHVLMQQQAASRQQFPHHH 138 P+ ++SP W+ ++ + Q S + P HH Sbjct: 15 PEQWEKWSPRWKSIVFRTQYESIFKNPKHH 44 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 25.0 bits (52), Expect = 5.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 102 RAAPRPYPQHPRQYSPEWRHVLMQ 125 RA P+PQ+PR + ++ H +Q Sbjct: 1937 RAFDNPWPQYPRVFRVDYGHAEVQ 1960 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.324 0.133 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 375,428 Number of Sequences: 5004 Number of extensions: 9549 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 154 length of database: 2,362,478 effective HSP length: 67 effective length of query: 87 effective length of database: 2,027,210 effective search space: 176367270 effective search space used: 176367270 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -