GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000901-TA|BGIBMGA000901-PA|undefined
         (154 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_54794| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.42 

>SB_54794| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 31.1 bits (67), Expect = 0.42
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 101 RRAAPRPYPQHPRQYSPEWRHVLMQQQAASRQQFPHHHQ 139
           R   P P P   R+ SPE    L +QQAA RQ+    H+
Sbjct: 101 RPLTPTPEPAEERKISPEMEEYL-RQQAAKRQELREKHK 138


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.324    0.133    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,007,222
Number of Sequences: 59808
Number of extensions: 83249
Number of successful extensions: 242
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 242
Number of HSP's gapped (non-prelim): 1
length of query: 154
length of database: 16,821,457
effective HSP length: 76
effective length of query: 78
effective length of database: 12,276,049
effective search space: 957531822
effective search space used: 957531822
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 56 (26.6 bits)