BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000900-TA|BGIBMGA000900-PA|undefined (364 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 9.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 9.5 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/42 (26%), Positives = 16/42 (38%) Query: 281 ATGGDWARYRGYGYRPRHTPPPIDHLHMSQQQQLHVTQPHHN 322 +T G G+G+ H P H H + H T H+ Sbjct: 410 STPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQHSTPLAHS 451 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 9.5 Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 210 DDGDDTFEDLITEISEYPEFMKD 232 +D + +F DL+T+++E + D Sbjct: 531 EDCNKSFNDLLTQVAELDQIYAD 553 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,567 Number of Sequences: 429 Number of extensions: 4395 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 364 length of database: 140,377 effective HSP length: 59 effective length of query: 305 effective length of database: 115,066 effective search space: 35095130 effective search space used: 35095130 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -