Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000898-TA|BGIBMGA000898-PA|undefined
         (173 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY321476-2|AAQ23387.1|  257|Tribolium castaneum Ase protein.           22   3.2  

>AY321476-2|AAQ23387.1|  257|Tribolium castaneum Ase protein.
          Length = 257

 Score = 21.8 bits (44), Expect = 3.2
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 4  QNRPGGKTGGGGVASWSESNRDRRERLRQL 33
          +++PGGKT    VA  +  N   R R++Q+
Sbjct: 40 KSKPGGKTAPQPVAV-ARRNARERNRVKQV 68


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.136    0.439 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,029
Number of Sequences: 317
Number of extensions: 1636
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 173
length of database: 114,650
effective HSP length: 53
effective length of query: 120
effective length of database: 97,849
effective search space: 11741880
effective search space used: 11741880
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.4 bits)
S2: 40 (20.2 bits)