BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000893-TA|BGIBMGA000893-PA|IPR008734|Phosphorylase kinase alphabeta (631 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 26 0.68 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 1.2 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 26.2 bits (55), Expect = 0.68 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 80 RRMSVRGAIKKTRSINVDSDTLGMEGEYVGPLLERKPSLLEVDPTHAGRSPSPEEAKKKV 139 R+++V G+ +++R +++ GE RK +VDPT EE V Sbjct: 387 RQLAVGGSQEESRVLDLSKPGCSYTGEQKS---RRKGPAFKVDPTQVESEEEDEETSTTV 443 Query: 140 FT 141 F+ Sbjct: 444 FS 445 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.4 bits (53), Expect = 1.2 Identities = 16/62 (25%), Positives = 27/62 (43%) Query: 132 PEEAKKKVFTKGTSTTNLGVAPPTIEITKDQTTSPPKEVVNKSPPVLRNRTVSESQSVVY 191 P+ K +G+S+++ GV + +S P +KSPPV S+ + Y Sbjct: 1085 PDPVALKSAQQGSSSSSEGVPLKGTAVPPPSGSSGPGSTGSKSPPVAGFEESPHSKFLKY 1144 Query: 192 AE 193 E Sbjct: 1145 TE 1146 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,217 Number of Sequences: 317 Number of extensions: 5421 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 631 length of database: 114,650 effective HSP length: 61 effective length of query: 570 effective length of database: 95,313 effective search space: 54328410 effective search space used: 54328410 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -