BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000889-TA|BGIBMGA000889-PA|undefined (131 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 3.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 4.9 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 4.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 4.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 4.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 8.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 8.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 8.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 8.6 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 3.7 Identities = 10/39 (25%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Query: 25 CLNLAYDIVKISSHIYKFRTTTFGP---SVYRANITRSV 60 C + Y++ +IS + Y + GP ++++ N T V Sbjct: 51 CALVNYNVSEISENFYYLPAMSTGPLKYAIFQKNFTNIV 89 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.6 bits (41), Expect = 4.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 2 VNKWSRRGVMWRVAIIQRRIFDGCLNLAYDIV 33 +NK R+G WR ++ FD +L + V Sbjct: 559 LNKLLRKGEKWRWGRNEQEAFDRVKDLFLEAV 590 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 113 YVVGEGSLKPVNV 125 Y GEGS KP N+ Sbjct: 36 YRNGEGSFKPQNI 48 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YA+ MQ + E+V+G Sbjct: 205 FEYAVGHWMQKATEHVIG 222 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YA+ MQ + E+V+G Sbjct: 519 FEYAVGHWMQKATEHVIG 536 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YA+ MQ + E+V+G Sbjct: 752 FEYAVGHWMQKATEHVIG 769 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 4.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YA+ MQ + E+V+G Sbjct: 752 FEYAVGHWMQKATEHVIG 769 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YAI +Q + E+V+G Sbjct: 779 FEYAIGHWLQKATEHVIG 796 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YAI +Q + E+V+G Sbjct: 779 FEYAIGHWLQKATEHVIG 796 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YAI +Q + E+V+G Sbjct: 779 FEYAIGHWLQKATEHVIG 796 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 99 FNYAINCSMQFSLEYVVG 116 F YAI +Q + E+V+G Sbjct: 779 FEYAIGHWLQKATEHVIG 796 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.327 0.137 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,459 Number of Sequences: 317 Number of extensions: 1097 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 131 length of database: 114,650 effective HSP length: 51 effective length of query: 80 effective length of database: 98,483 effective search space: 7878640 effective search space used: 7878640 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.2 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -