BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000889-TA|BGIBMGA000889-PA|undefined (131 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0343 + 9163976-9165220 29 1.2 03_01_0575 + 4247431-4247489,4248475-4248547,4248792-4249229,425... 26 8.6 >02_02_0343 + 9163976-9165220 Length = 414 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/50 (26%), Positives = 27/50 (54%) Query: 59 SVEDLPLCRLASQKGIQNIIRAIQLTNMTAVWCSDRAGAGFNYAINCSMQ 108 S+ +L +CR +S + + + LT++T + C D GF+ I +++ Sbjct: 196 SLRELSICRESSMQSMALLSNLTSLTHLTLLECEDLTVDGFDPLITLNLK 245 >03_01_0575 + 4247431-4247489,4248475-4248547,4248792-4249229, 4252122-4253339 Length = 595 Score = 26.2 bits (55), Expect = 8.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 26 LNLAYDIVKISSHIYKFRTTTFGPSV 51 L+++ D+V++ H K TT GP V Sbjct: 414 LSISRDLVEVGGHALKTNITTLGPLV 439 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.327 0.137 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,657,021 Number of Sequences: 37544 Number of extensions: 126099 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 280 Number of HSP's gapped (non-prelim): 2 length of query: 131 length of database: 14,793,348 effective HSP length: 74 effective length of query: 57 effective length of database: 12,015,092 effective search space: 684860244 effective search space used: 684860244 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -