BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000885-TA|BGIBMGA000885-PA|undefined (136 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12923| Best HMM Match : zf-C3HC4 (HMM E-Value=1.1) 27 5.4 SB_43647| Best HMM Match : VPS9 (HMM E-Value=1.1e-12) 27 7.2 >SB_12923| Best HMM Match : zf-C3HC4 (HMM E-Value=1.1) Length = 166 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 61 PTNTSCPSCSAAIVTRVDHVPVTKTHLFALLLCL 94 P T+CP C IVTR T+ + LC+ Sbjct: 42 PVYTTCPFCQEKIVTRTSFKSGKYTYWTSACLCI 75 >SB_43647| Best HMM Match : VPS9 (HMM E-Value=1.1e-12) Length = 849 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Query: 103 IPTARTPAKMQTITVRIATRTL 124 IP+A + AK+ TVR+ TRTL Sbjct: 546 IPSAESTAKVSISTVRLNTRTL 567 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.324 0.133 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,542,196 Number of Sequences: 59808 Number of extensions: 115100 Number of successful extensions: 410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 408 Number of HSP's gapped (non-prelim): 2 length of query: 136 length of database: 16,821,457 effective HSP length: 75 effective length of query: 61 effective length of database: 12,335,857 effective search space: 752487277 effective search space used: 752487277 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -