BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000884-TA|BGIBMGA000884-PA|IPR006629|LPS-induced tumor necrosis factor alpha factor, IPR007087|Zinc finger, C2H2-type (164 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1043 + 8228201-8228209,8228364-8228439,8228527-8228903 29 1.8 02_03_0408 - 18692176-18692278,18692590-18692669,18692764-186928... 27 7.4 >01_01_1043 + 8228201-8228209,8228364-8228439,8228527-8228903 Length = 153 Score = 29.1 bits (62), Expect = 1.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 135 CACIPYCMESCQNATHYCPNCHAY 158 CAC+ C SC ++ P+C+ Y Sbjct: 102 CACVKVCAASCHHSPCSLPDCYFY 125 >02_03_0408 - 18692176-18692278,18692590-18692669,18692764-18692890, 18694016-18694051,18695832-18696085 Length = 199 Score = 27.1 bits (57), Expect = 7.4 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 11/70 (15%) Query: 96 PSSLTCPSCNAVIVTRVQHDAS--------SKTHLFALILCLIGCWPCACIPYC--MESC 145 P+ C +C A V+ ++ + + SK L +++ C++ C C M+ Sbjct: 68 PAPFHCQACGAAAVSSLRSEDTIFFPVHGRSKPSLASVVACMMPFMMGVCF-LCPSMDCL 126 Query: 146 QNATHYCPNC 155 + HYCP+C Sbjct: 127 WHKYHYCPSC 136 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.326 0.135 0.455 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,145,258 Number of Sequences: 37544 Number of extensions: 133567 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 449 Number of HSP's gapped (non-prelim): 2 length of query: 164 length of database: 14,793,348 effective HSP length: 77 effective length of query: 87 effective length of database: 11,902,460 effective search space: 1035514020 effective search space used: 1035514020 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -