BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000881-TA|BGIBMGA000881-PA|IPR003599|Immunoglobulin subtype, IPR001254|Peptidase S1 and S6, chymotrypsin/Hap (308 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.93 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.6 bits (51), Expect = 0.93 Identities = 13/47 (27%), Positives = 23/47 (48%) Query: 181 PTNMSLDRGDCAVTINNVKYDDYGTWTCGAGLDDGNEHTDTINVKVK 227 P N + D +TINN++ + G + C A G+ + I + V+ Sbjct: 748 PNNPDIKVEDGTLTINNIQKTNEGYYLCEAVNGIGSGLSAVIQISVQ 794 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 153 RFEPPKGRPFNIAEDVTPDNAI 174 RFEPP+ R E V P N++ Sbjct: 410 RFEPPQIRHAFNEETVQPGNSV 431 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,582 Number of Sequences: 317 Number of extensions: 3052 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 308 length of database: 114,650 effective HSP length: 57 effective length of query: 251 effective length of database: 96,581 effective search space: 24241831 effective search space used: 24241831 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -