BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000881-TA|BGIBMGA000881-PA|IPR003599|Immunoglobulin subtype, IPR001254|Peptidase S1 and S6, chymotrypsin/Hap (308 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0535 - 16850704-16853001,16854055-16854115,16854228-168543... 32 0.51 11_01_0738 - 6218730-6220173,6221969-6223056 29 3.6 >04_03_0535 - 16850704-16853001,16854055-16854115,16854228-16854323, 16854394-16854521,16855016-16855067,16855182-16855274, 16855473-16855590,16856456-16856609,16857512-16857643, 16859136-16859216,16859353-16859507,16860118-16860343, 16860423-16860507,16860593-16860689,16861785-16861949, 16862046-16862121,16863041-16863103,16863193-16863359, 16863495-16863669,16863743-16863835,16864694-16864810, 16865589-16865778,16866092-16866126 Length = 1618 Score = 32.3 bits (70), Expect = 0.51 Identities = 27/83 (32%), Positives = 33/83 (39%), Gaps = 13/83 (15%) Query: 145 RLTPLSYCRFEPPK-GRPFNIAEDVTPDNAILGRFYFPTNMSL-----DRGDCAVTINNV 198 R+ P P + GR + E PDN I F NM L D C +TINN Sbjct: 127 RIVPSICANLSPDQLGRVKGVVECSNPDNDIRR---FDANMRLFPPIIDSEKCPLTINNT 183 Query: 199 K----YDDYGTWTCGAGLDDGNE 217 Y Y W CG + GN+ Sbjct: 184 LLQSCYLRYTEWACGVAVYTGNQ 206 >11_01_0738 - 6218730-6220173,6221969-6223056 Length = 843 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 94 GEWRCHSGGHETGVEIIKTIELRVVNEVTALWKNVTVLHAKSVSLVCLTTKRLTP 148 G WR GH G ++ I +R N T + N T A +V L + L+P Sbjct: 715 GLWRDEGDGHSAGNPVLYDINMRRYN--TFFYSNSTSFMASITVIVLLLQRMLSP 767 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.136 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,059,154 Number of Sequences: 37544 Number of extensions: 372654 Number of successful extensions: 765 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 765 Number of HSP's gapped (non-prelim): 2 length of query: 308 length of database: 14,793,348 effective HSP length: 82 effective length of query: 226 effective length of database: 11,714,740 effective search space: 2647531240 effective search space used: 2647531240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -