BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000881-TA|BGIBMGA000881-PA|IPR003599|Immunoglobulin subtype, IPR001254|Peptidase S1 and S6, chymotrypsin/Hap (308 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 23 8.2 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 8.2 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.4 bits (48), Expect = 8.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 18 FPASIQGYRHFIDLETDGVETIFATENENVNIECKTD 54 FPA + G R + L+ + + +N+ IE K D Sbjct: 133 FPAEVVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVD 169 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 74 GTTLSAGHCFKNITVTPEDDGEWRCHSGGHETG 106 GT ++ C N+T+ E G + +GG G Sbjct: 1125 GTCAASQGCMNNVTIGDEGWGYYETVAGGSGAG 1157 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.136 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 314,319 Number of Sequences: 2123 Number of extensions: 12337 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 308 length of database: 516,269 effective HSP length: 64 effective length of query: 244 effective length of database: 380,397 effective search space: 92816868 effective search space used: 92816868 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -