GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000880-TA|BGIBMGA000880-PA|IPR001650|Helicase,
C-terminal
         (539 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    27   0.96 

>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
            gambiae RT2 retroposon. ).
          Length = 1222

 Score = 27.5 bits (58), Expect = 0.96
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 467  MIRDEDSGFAIGHGSKRVNKMLAGQSMGEEKGKLSELLVARGLITPQMLKKLQQELSTDK 526
            ++RD DS   I  G+KR+   L  ++  EE+  L+  ++ R     +   +L+ + +  +
Sbjct: 1049 LLRDADSWSRICEGAKRITAQLQ-RAWDEERAALAVNVIER---QDEDAAELEAQRAEVR 1104

Query: 527  KIDRTKKNRNRR 538
            +    ++N NRR
Sbjct: 1105 RARNERRNANRR 1116


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 551,912
Number of Sequences: 2123
Number of extensions: 22712
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 47
Number of HSP's gapped (non-prelim): 1
length of query: 539
length of database: 516,269
effective HSP length: 67
effective length of query: 472
effective length of database: 374,028
effective search space: 176541216
effective search space used: 176541216
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 50 (24.2 bits)