SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000878-TA|BGIBMGA000878-PA|undefined
         (716 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like prote...    24   3.1  

>AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like protein
           protein.
          Length = 314

 Score = 24.2 bits (50), Expect = 3.1
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 433 PNSYSAVTDPIDLVCGRGGDLAMLESPLKHGIENIESLTTLDNTISEGDRDDQTDDE 489
           P  + ++ + I+   G+G  +  L SPL H +        +D    E   DD  DD+
Sbjct: 240 PGGFPSIHNSINPFLGQGFAVPGL-SPLGHTLSMNHKYEKIDKEEHESMDDDDDDDD 295


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.136    0.408 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,232
Number of Sequences: 317
Number of extensions: 5295
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 716
length of database: 114,650
effective HSP length: 62
effective length of query: 654
effective length of database: 94,996
effective search space: 62127384
effective search space used: 62127384
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -