BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000878-TA|BGIBMGA000878-PA|undefined
(716 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 24 3.1
>AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein
protein.
Length = 314
Score = 24.2 bits (50), Expect = 3.1
Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
Query: 433 PNSYSAVTDPIDLVCGRGGDLAMLESPLKHGIENIESLTTLDNTISEGDRDDQTDDE 489
P + ++ + I+ G+G + L SPL H + +D E DD DD+
Sbjct: 240 PGGFPSIHNSINPFLGQGFAVPGL-SPLGHTLSMNHKYEKIDKEEHESMDDDDDDDD 295
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.319 0.136 0.408
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,232
Number of Sequences: 317
Number of extensions: 5295
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 716
length of database: 114,650
effective HSP length: 62
effective length of query: 654
effective length of database: 94,996
effective search space: 62127384
effective search space used: 62127384
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -