GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000878-TA|BGIBMGA000878-PA|undefined
         (716 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83222-1|CAB05712.1|  410|Caenorhabditis elegans Hypothetical pr...    32   1.2  

>Z83222-1|CAB05712.1|  410|Caenorhabditis elegans Hypothetical
           protein E01B7.1 protein.
          Length = 410

 Score = 32.3 bits (70), Expect = 1.2
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 319 RALRANSLQGVVAQTHASSPRCSAYLAAQLKELAAVLKAQTPPAPAIP 366
           R++ ++ L  V++  H + P  S      L  +     AQTPPAPA P
Sbjct: 297 RSIPSDELDDVISAYHRNYPMISEIRYPDLNTMRPEPTAQTPPAPAAP 344


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.319    0.136    0.408 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,490,608
Number of Sequences: 27539
Number of extensions: 566942
Number of successful extensions: 1114
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1113
Number of HSP's gapped (non-prelim): 1
length of query: 716
length of database: 12,573,161
effective HSP length: 87
effective length of query: 629
effective length of database: 10,177,268
effective search space: 6401501572
effective search space used: 6401501572
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 63 (29.5 bits)